PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.128620.1
Common NameCsa_7G413890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 281aa    MW: 32358.5 Da    PI: 4.9791
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.128620.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-182774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l ++v+ +G g+W+++ar+ g++Rt+k+c++rw++yl
   Cucsa.128620.1 27 KGPWTAEEDSVLFNYVNCHGEGRWNAVARCTGLKRTGKSCRLRWLNYL 74
                     79********************************************97 PP

2Myb_DNA-binding46.96.3e-1580123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   Cucsa.128620.1  80 RGNITLQEQLLILELHFRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 123
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.1412278IPR017930Myb domain
SuperFamilySSF466894.87E-3124121IPR009057Homeodomain-like
SMARTSM007172.2E-142676IPR001005SANT/Myb domain
PfamPF002491.1E-152774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-222881IPR009057Homeodomain-like
CDDcd001671.18E-102974No hitNo description
PROSITE profilePS5129417.20979129IPR017930Myb domain
SMARTSM007173.4E-1379127IPR001005SANT/Myb domain
PfamPF002497.3E-1480123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2182128IPR009057Homeodomain-like
CDDcd001671.38E-6100123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDVKMRGFRC GEPQKIKEEE EEMDVRKGPW TAEEDSVLFN YVNCHGEGRW NAVARCTGLK  60
RTGKSCRLRW LNYLRPSVRR GNITLQEQLL ILELHFRWGN RWSKIAQYLP GRTDNEIKNY  120
WRTRVQKQAK QLNCDVNSKQ FRDAMRYVWM PRLLERIQAS TDSTTTIVDV IQPPHPPLEL  180
TQSSPSGSSW VNPHVAPTTS SSDSISDQVQ LQVSPVSDMT ENFNMVDKSE EDGMMMLMEH  240
GCDGEAMINE WIGGGEVLEN GLWNEEDMWT LLQQQFGDDV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-242412924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0369010.0FJ036901.1 Cucumis sativus clone CU20C06 myb-like transcription factor Myb5 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004136147.20.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE12e-75MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0A0K5V30.0A0A0A0K5V3_CUCSA; Uncharacterized protein
STRINGVIT_07s0005g01950.t012e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-77myb domain protein 78
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]